Home  |   About us
ITEM PROTEIN ANTIBODY ASSAY KIT CELL
Polyclonal Antibody to Keratin 6A (KRT6A)
K6A; KRT6C; KRT6D; CK6C; K6C; CK6D; K6D; Keratin 6C; Keratin 6D
Organism species Homo sapiens (Human)
Product No.PAD234Hu01
ClonalityPolyclonal
HostRabbit
Immunoglobulin TypeIgG
PurificationAffinity Chromatography
ApplicationsWB, ICC, IHC-P, IHC-F, ELISA
Concentration200ug/ml
UOM100ug
ConjugateNo Conjugate
IMMUNOGEN INFORMATION
Immunogen: Recombinant KRT6A (Glu163~Leu468) expressed in E.coli.
Accession No.: RPD234Hu01
Sequence: The target protein is fused with two N-terminal Tags, His-tag and S-tag and its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-EREQIKTL NNKFASFIDK VRFLEQQNKV LETKWTLLQE QGTKTVRQNL EPLFEQYINN LRRQLDSIVG ERGRLDSELR GMQDLVEDFK NKYEDEINKR TAAENEFVTL KKDVDAAYMN KVELQAKADT LTDEINFLRA LYDAELSQMQ THISDTSVVL SMDNNRNLDL DSIIAEVKAQ YEEIAQRSRA EAESWYQTKY EELQVTAGRH GDDLRNTKQE IAEINRMIQR LRSEIDHVKK QCANLQAAIA DAEQRGEMAL KDAKNKLEGL EDALQKAKQD LARLLKEYQE LMNVKLALDV EIATYRKL
ANTIBODY SPECIFITY
The antibody is a rabbit polyclonal antibody raised against KRT6A. It has been selected for its ability to recognize KRT6A in immunohistochemical staining and western blotting.
APPLICATIONS
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Optimal working dilutions must be determined by end user.
CONTENTS
Form & Buffer: Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
QUALITY CONTROL
Content: The quality control contains recombinant KRT6A (Glu163~Leu468) disposed in loading buffer.
Usage: 10uL per well when 3,3'-Diaminobenzidine(DAB) as the substrate.
                5uL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control. Not used for other purposes.
Loading Buffer: 100mM Tris(pH8.8), 2% SDS, 200mM NaCl, 50% glycerol, BPB 0.01%, NaN3 0.02%.
STORAGE
Store at 4oC for frequent use. Stored at -20oC to -80oC in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Package and Components
Download
Benchmark price
Catalog No. Related products for research use of Homo sapiens (Human) Organism species Applications
MAD234Hu21Monoclonal Antibody to Keratin 6A (KRT6A)WB, ICC, IHC-P, IHC-F, ELISA
PAD234Hu01Polyclonal Antibody to Keratin 6A (KRT6A)WB, ICC, IHC-P, IHC-F, ELISA
PAD234Hu71Biotin-Linked Antibody to Keratin 6A (KRT6A)IHC;WB;ELISA
PAD234Hu81FITC-Linked Antibody to Keratin 6A (KRT6A)IHC;ICC;IF;WB
RPD234Hu01Recombinant Keratin 6A (KRT6A)SDS-PAGE; WB; ELISA; IP.
SED234HuELISA Kit for Keratin 6A (KRT6A)Enzyme-linked immunosorbent assay